SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TN50|A7TN50_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TN50|A7TN50_VANPO
Domain Number 1 Region: 1-159
Classification Level Classification E-value
Superfamily GINS helical bundle-like 6.02e-40
Family PSF1 N-terminal domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TN50|A7TN50_VANPO
Sequence length 209
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1053p4
Sequence
MYGDLANKLVLEAKRSQQLSNKSKKGNSLPMYHEELVRNILQEVVQLSKNTEYLKEQQQL
GNMDSKVWKCQQFVMLLCMERNKRCLLAYQRLRSQMLDSLAWDNNGLDILHDTLGNTQDT
TDLSPQEQEYLKEYSELITELKSGALTDIDLTGSLTPPSDVFIDVRVLKDAGEIQTEYGV
FNLIKDSQFFVRQSDVERLIQQGYLQKIK
Download sequence
Identical sequences A7TN50
436907.A7TN50 XP_001644126.1.22633 tr|A7TN50|A7TN50_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]