SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TN73|A7TN73_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TN73|A7TN73_VANPO
Domain Number 1 Region: 58-105,146-244
Classification Level Classification E-value
Superfamily GINS helical bundle-like 3.92e-42
Family SLD5 N-terminal domain-like 0.00091
Further Details:      
 
Domain Number 2 Region: 249-315
Classification Level Classification E-value
Superfamily PriA/YqbF domain 0.00000000131
Family SLD5 C-terminal domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TN73|A7TN73_VANPO
Sequence length 315
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1053p28
Sequence
MNIDIDDILADLDRDTTAVDHTQDNFTSDGNTTRLNTSLDYSISGELNGKIGRSSEIISP
AEDFAQLMRCWRNERCSPELMPYPHYLMTRILRRIQEQMEHIENISMGFLEESMNQISHG
SGNVTGDGDDEDDEFGMGRGNNVINNNNKLPLLCMEAELERVKFVIRSFIRCRLNKIDKY
SLYLKQIEDDSMNFLPINELLSKEEMVYHEKHLSILLKLFNNSILRHMPPELQAINDTEG
TLNMIEEPDWKKFVFIYIKEVKDDSTLDRNEFGKPCYTVTIEELNEIVELTIGGIYVMRY
EIIRQLVLDQKAYLI
Download sequence
Identical sequences A7TN73
XP_001644149.1.22633 436907.A7TN73 tr|A7TN73|A7TN73_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]