SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TN84|A7TN84_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TN84|A7TN84_VANPO
Domain Number 1 Region: 29-230
Classification Level Classification E-value
Superfamily Dihydrofolate reductase-like 4.08e-36
Family RibD C-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TN84|A7TN84_VANPO
Sequence length 242
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1053p40
Sequence
MSLLELPINIPEILSPYLPLKDDLVKDKPFVTLTYAQSIDARIAAQKGERTVISHEETKT
MTHYLRYHHDGILVGTGTVLADDPGLNCKWGKNCFENSPKPIIIDLKQKWKFTGSKLHQL
YLNNQGKNPIVVVANEPINKEEHVEYLTIPTTNGKFDWGLLLNALKTNFNLNSIMVEGGA
VVINQLLTESHLINSLIVTIGSTYLGNLGVQVSPPRKVLLENVNWWRGTTDAVMCANLKQ
LK
Download sequence
Identical sequences A7TN84
436907.A7TN84 tr|A7TN84|A7TN84_VANPO XP_001644160.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]