SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TNA0|A7TNA0_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TNA0|A7TNA0_VANPO
Domain Number 1 Region: 50-359
Classification Level Classification E-value
Superfamily Aldolase 1.3e-94
Family HMGL-like 0.0000000288
Further Details:      
 
Domain Number 2 Region: 480-594
Classification Level Classification E-value
Superfamily 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 2.62e-33
Family 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain 0.00094
Further Details:      
 
Domain Number 3 Region: 422-470
Classification Level Classification E-value
Superfamily post-HMGL domain-like 0.000000000000122
Family DmpG/LeuA communication domain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TNA0|A7TNA0_VANPO
Sequence length 614
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_505p9
Sequence
MFIKQSFVLLAQHASRSSKHIPPVKLSYKNMLKDPSSKYKPFIRPTLNKRNWPNNLITKA
PRWLSTDLRDGNQSLPDPMSVEQKKEYFHKLVDIGFKEIEVSFPSASQTDFDFTRYAVEN
APDDVTIQCLVQSREHLIKRTVEALTGAKRATVHTYLATSDMFRDIVFNMSKEEAIEKAV
EATKLVRSLTKDDPTKQDTIWNYQFSPECFSDTPVEFAVEICEAVKNAWEPTVENPIIFN
LPATVEVATPNIYADQIEYFSTHITEREKVCISTHTHNDRGCGVAASELGILAGADRVEG
CLFGNGERTGNVDLVTVALNMYTQGIPPNLDFSDINSLIEVVERCNKIPVSPRAPYGGEL
VVCAFSGSHQDAIKKGFSVQEKRRAQGDKYWRIPYLPLDPKDIGRDYEAVIRVNSQSGKG
GAAWVILRSLGLDLPRNMQIEFSNIVQDNADAIGKELQSGEISQLFKKTYNYNNESGSYI
SLLDYNVQKLDSERRIFSGQVEIAGEVVPIEGNGNGPISSFIDALSNLLNVKLGVANYAE
HSIGSGSNTQAASYVHLTYRRYSDNEKAYKWGVGLSKDVGDASVQAILTTINNIIKSGEI
TLPKVQAAKKAGHA
Download sequence
Identical sequences A7TNA0
tr|A7TNA0|A7TNA0_VANPO 436907.A7TNA0 XP_001644090.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]