SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TNB7|A7TNB7_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  tr|A7TNB7|A7TNB7_VANPO
Domain Number - Region: 35-85
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 0.0112
Family Frataxin-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TNB7|A7TNB7_VANPO
Sequence length 280
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_505p26
Sequence
MKLSTATFVLAAATLGTSTKLFPNSTDIISEIEYSEPFFIKFANGTLSDILDYFENNDIV
NFVEYEINSGNLPITFGGDTSSIFNINDIESLLSQEFRLSSLGQLLNTANETADNFYGKG
YSISGGLLNFKGLNNWTINLNGPNLNINLPGSTFTTTTGLMPVVLSAVTQDGTTLSNFPN
TPVSANVKREEPVSNITSSEIQNTTSTVPITTSSFHSYVNSTGFETATSVPSAIQSSISR
NHTNGTRPSTISSNFEGFALRNDVSCGSLMGCVAVALLLI
Download sequence
Identical sequences A7TNB7
XP_001644107.1.22633 436907.A7TNB7 tr|A7TNB7|A7TNB7_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]