SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TNU1|A7TNU1_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TNU1|A7TNU1_VANPO
Domain Number 1 Region: 156-293
Classification Level Classification E-value
Superfamily PR-1-like 3.79e-45
Family PR-1-like 0.0000879
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TNU1|A7TNU1_VANPO
Sequence length 296
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1016p27
Sequence
MKFSKISSIAALSSVALAAPAMVTVTEHVHASPTVTVQGVIYFQDGAAVTSFTTIGAAAD
PTPVAAAAATAAAPAVANVNLVGNNVVDAQAATTQAQVQVQAVASTTEAAAPVQTTEAAA
PVQTTEAAAPVQTTETSAAAAPAATTAQDNSNNSNLSDFANTILNAHNAKRALHQDTNSL
SWSDDLASYAQNYANNYDCSGNLVHSGGAYGENLALGYSASGAVDVWYDEISGYDFSNPG
YSPATGHFTQLVWKSSTQIGCGIKNCNNEWGNYVICSYNPAGNFIGEFAQNVGNLK
Download sequence
Identical sequences A7TNU1
436907.A7TNU1 tr|A7TNU1|A7TNU1_VANPO XP_001643942.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]