SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TNW9|A7TNW9_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TNW9|A7TNW9_VANPO
Domain Number 1 Region: 5-202
Classification Level Classification E-value
Superfamily Cyclophilin-like 3.65e-53
Family Cyclophilin (peptidylprolyl isomerase) 0.0000151
Further Details:      
 
Domain Number 2 Region: 238-380
Classification Level Classification E-value
Superfamily TPR-like 2.23e-19
Family Tetratricopeptide repeat (TPR) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TNW9|A7TNW9_VANPO
Sequence length 391
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1067p25
Sequence
MEDTLVYLDISIGEDRIGRIVCQLFDEKAPKAVKNFISLCTGDVTVDGVGELTLKGNIYH
RIIRNFMIQCGDIIYGNGKFEKSSQIGTGGCSIYATEQELGSDENQLKCYGLFEDENMGE
FTEPFLLAMANTGNPNSNSSQFFITVAPQPHLNGKHTIFGKVLYGKHVVRTIENSPVDSD
GFPSSCVKIDDCGIWNDSMDVPLYNACNNTIGGDIYEEDPNDDINFDPEDSSKAYEATNT
IKESGTLLFKQKDYQNALLKYKKSLKYVNEFIPEMEVNKDNCILFTVLKMKLYLNISLVY
FNLKDNDNCITYTTYLLDMENVPDLDQAKAYYRRGNAYFAKKRLEEALNDYKNCQLKNPS
DKVINDKIDLVESQIEAQKEKTKKNIAKFFS
Download sequence
Identical sequences A7TNW9
XP_001643910.1.22633 tr|A7TNW9|A7TNW9_VANPO 436907.A7TNW9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]