SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TP31|A7TP31_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TP31|A7TP31_VANPO
Domain Number 1 Region: 90-178
Classification Level Classification E-value
Superfamily PUA domain-like 1.37e-22
Family PUA domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TP31|A7TP31_VANPO
Sequence length 181
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_499p28
Sequence
MFKKFSKEDIHSRSKVKSSIQRTLKSKLVSQYPQLEEVIDELIPKKSQIELIKCEDKIQL
YTVDGEVYFFQKFDELIPSLKFVHKFPQAYPTIQVDRGAIKFVLSGANIMCPGLTSVGGK
LPDAPGFEKDSFVIINAENKENALAIGKLMMSTEEIKSINKGHGVEMIHHLGDPLWDFNL
D
Download sequence
Identical sequences A7TP31
tr|A7TP31|A7TP31_VANPO 436907.A7TP31 XP_001643858.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]