SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TPD8|A7TPD8_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TPD8|A7TPD8_VANPO
Domain Number 1 Region: 44-263
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.95e-63
Family G proteins 0.000000171
Further Details:      
 
Domain Number 2 Region: 242-337
Classification Level Classification E-value
Superfamily Translation proteins 1.02e-30
Family Elongation factors 0.0000188
Further Details:      
 
Domain Number 3 Region: 337-435
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 3.17e-29
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TPD8|A7TPD8_VANPO
Sequence length 436
Comment Elongation factor Tu OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1009p12
Sequence
MLLSKTSLFTRAVGSKLPKVVFSATTKSTFPIISQRCYASFDRSKPHVNIGTIGHVDHGK
TTLTAAITKTLAKSGGADFLDYASIDKAPEERARGITISTAHVEYETDKRHYSHVDCPGH
ADYIKNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQHLVVFVNKVDTIDDPE
MLELVEMEMRELLTQYGFDGDNVPVVMGSALCALEDREPEIGENAIKKLMAAVDEYIPTP
ERDLEKPFLMPVEDIFSISGRGTVVTGRVERGQLKKNEEIEIVGHTKTPIKATVTGIEMF
RKELDQAMAGDNAGVLLRGIRRDEIKRGMVLAKPGTVKAHTKVLASLYILSKEEGGRHSG
FGENYRPQMYIRTADVTVVMKFPQEVEDHSKQVMPGDNVEMECELIHPTPLEVGQRFNIR
EGGRTVGTGLITRIIE
Download sequence
Identical sequences A7TPD8
XP_001643724.1.22633 tr|A7TPD8|A7TPD8_VANPO 436907.A7TPD8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]