SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TPE6|A7TPE6_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TPE6|A7TPE6_VANPO
Domain Number 1 Region: 143-233,375-472,904-1114
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.88e-53
Family Calcium ATPase, transmembrane domain M 0.025
Further Details:      
 
Domain Number 2 Region: 467-490,669-775,829-897
Classification Level Classification E-value
Superfamily HAD-like 8.66e-30
Family Meta-cation ATPase, catalytic domain P 0.084
Further Details:      
 
Domain Number 3 Region: 484-500,539-730
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 4.14e-20
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0087
Further Details:      
 
Domain Number 4 Region: 237-299,333-371
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.88e-18
Family Calcium ATPase, transduction domain A 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TPE6|A7TPE6_VANPO
Sequence length 1126
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1009p21
Sequence
MDFPSSANTNTFDSQFDRALDNLHINNKSDNSNSNSNTWQEDNLYQENFEIQSLSKRMSN
NLDSHPLLNEGTTNYVPVDNNGYIAMNQSSSYSKLFNRILKFVQSRTNVRLTKYRSISDA
EVDRVQDYSEREIHPDTTPIYDRNKYPSNEISNAKYNAFNFLPILLYEQFKFFFNLYFLL
VALSQIIPALRIGYLSSYIVPLAFVLTVTMLKEAMDDIRRRKRDKEANNELYQVLAKSSQ
LVPSKDLKVGDLVKLKKGERIPADLVLLQSSEPSGEAFIKTDQLDGETDWKLRVASHLTQ
NLTEDDLMNKISITTSAPEKSIDSFLGKVTYKGATSNPLNVDNTLWANTVLASTGTCVGC
VIYTGKDTRQAMNTTKPTVKTGLLELEINSISKILCISVFVLSIFIVICAGFKNNDWYID
IMRYLILFSTIIPVSLRVNLDLAKSVYAYQIEHDDTIKDTIVRTSTIPEDLGRIEYILTD
KTGTLTQNDMQLKKLNLGSVSYTSETLDIVSNYIETLVESSKSTTNPTSRSAARKDVSAR
VKDLVVTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRNSITLLHEH
SGVTLNYQILQVFPFNSDSKRMGIIIHDQQKDEYWFLQKGADTVMTKIVESTEWLEEETG
NMAREGLRTLVIGRKKLSNKVYQQFRKDYDHASLAMVKRDEKMANTITKYLEHDLELLGL
TGVEDKLQRNVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLINRGQYVHVITKVNK
PEGALSQLEYLKINRNSCLLIDGESLAMYLKYFKTEFFNVTVNLPTVIACRCTPQQKADI
ALLIREMTQKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCYLTELL
LWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSNFEPIALYKGWLMVGYATCYTMAP
VFSLTLDRDIDESLTKIYPELYKDLTEGKSLSYKTFFTWVTLSLFQGTVIQLFSQTFTSI
EPVDFEKMVSISFVCLVINELIMVALEIYTWHRAMVISEIVTFAFFILSIPFLGEYFDLK
YMIRPSYWFILIFILLFSILPVWVMKSIYRRLHPPSYAKVQQFSLV
Download sequence
Identical sequences A7TPE6
tr|A7TPE6|A7TPE6_VANPO XP_001643732.1.22633 436907.A7TPE6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]