SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TPK5|A7TPK5_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TPK5|A7TPK5_VANPO
Domain Number 1 Region: 196-284,430-551,1000-1231
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.57e-62
Family Calcium ATPase, transmembrane domain M 0.016
Further Details:      
 
Domain Number 2 Region: 545-569,769-872,925-995
Classification Level Classification E-value
Superfamily HAD-like 7.42e-35
Family Meta-cation ATPase, catalytic domain P 0.08
Further Details:      
 
Domain Number 3 Region: 563-579,620-816
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 6.98e-24
Family Metal cation-transporting ATPase, ATP-binding domain N 0.007
Further Details:      
 
Domain Number 4 Region: 293-353,388-429
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 6.54e-17
Family Calcium ATPase, transduction domain A 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TPK5|A7TPK5_VANPO
Sequence length 1355
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1040p10
Sequence
MNDNNRHQGTPDSTLFDLDSIEGDTNGGAHNSHSDRFQLRDADGNNNSLFQETIDLERDD
NIESDVRRNPFINDSEDDGSFELNRFDGVENHNPQLHQVGRTPNIFTRAFNRVRKGLGRD
ADRTRGNRFGEFEMSNYNKVSNDEDLGDVYDKSRNQFDMKMLFNRYILRKGGSNLNNPDE
PRLIHLNDKTANNSLGYRNNHISTTKYNAGTFLPKFLFQEFSKYANLFFLFTSIIQQVPN
VSPTNRYTTIGTLVVVLIVSAIKESVEDIKRANSDKELNYSRVEVFSEIEADFVIKRWVD
IQVGDIVKVKSEEAVPADLIVLSSSEPEGLCYIETANLDGETNLKIKQSRIETSKYIKSS
QLSQLRGKVLSEQPNSSLYTYEGTMTLNGQEIPLSPEQMILRGATLRNTAWIFGIVIFTG
HETKLMRNATATPIKRTAVERVINLQILALFGLLIGLALISSFGNVIMLASKGNELSYLY
LEGTSRVGLFFKDILTYWILYSNLVPISMFVTVELIKYYQAYMISSDLDLYYETTDTPTV
VRTSSLVEELGQIEYVFSDKTGTLTRNIMEFKSCSIAGSCYIEKIPEDKAATMEDGIEIG
YRSFDELNSRLHSKTYEDSNVINYFLTLLATCHTVIPEFQSDGSIKYQAASPDEGALVQG
AADLGYKFIVRKPNSVRVLIEDSGEEKEYQLLNICEFNSTRKRMSAIFKLPDGSIKLFCK
GADTVILERLDPDDNEFVDATMRHLEDYASEGLRTLCLGMRDISNEEYEEWSEIYNSAAT
TLDDRSTKLDEAAELIEKNLILIGATAIEDKLQEDVPETIHTLQEAGIRIWVLTGDRQET
AINIGMSCSLLSEDMNLLVINENSKEDTRKNLLEKIAAIDDHQLSAQDLSTLAMVIDGKS
LGYALEPDLEDYLLKIGTLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSM
IQAAHVGVGISGMEGMQASRSADFAIGQFKYLKKLLLVHGSWSYQRISVAILYSFYKNIA
LYMAQFWYVFSNAFSGQSIIESWTLTFYNLFFTVLPPFVIGVFDQFISSRLLEKYPQLYK
LGQKGQFFSVPIFWGWVANGFYHSAVTYVGSYLFYRNGFALNHHGEVADHWTWGTSIYTT
SVLIVLGKAALITNQWTKFTLLAIPGSFIFWLVFFPIYASIFPHANVSTEYFGVVTHTYG
SATFWLMLLVLPIFALLRDFAWKYYRRMYIPQAYHVVQEMQKYKIKDYRPQVQHFQNAIR
KVRQVQRIKKQRGFAFSQSEEGGQDKIIRMYDTTQRRGMYGELHDASANPFRDENQETML
EHESINSLTNNPFEDPTNDENSDYVNIHKTDSFEI
Download sequence
Identical sequences A7TPK5
436907.A7TPK5 tr|A7TPK5|A7TPK5_VANPO XP_001643655.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]