SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TPP6|A7TPP6_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  tr|A7TPP6|A7TPP6_VANPO
Domain Number - Region: 565-646
Classification Level Classification E-value
Superfamily Tropomyosin 0.00262
Family Tropomyosin 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TPP6|A7TPP6_VANPO
Sequence length 783
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1049p5
Sequence
MENYSSDTSYSASSSHGHEVGSSPLSNGLSNLNRKNNNRYKKDGMSSVDNEVSSMKNEIG
LRNGRGRLDYNVFNDRNNTYNLLRGAENGDVDDDDDDDDDDENDDGIDGDGTDGGIDSSG
LTIPKLQESMTPWRSLAGNRIGYKEIGDKSKLDTLSPSNSRASVINSLFSIDGAPTTAPA
SAGSLEIEQLQKQVTTYRLKIRTLFELIKQLSNVDDTSPDGKRDSFYKNLLKTISQNDEV
EELRKQLEDLEISNIGIVDELHAKVDTLNKELTDTKKDHQATLEYVNEYIEHSEQVSNNI
DEMLSMLMEKLYKISPEEKDALQKAKDISSSFVMVKMNALISTMRRVLDDLKEYQTQEND
SFVIANSTEIKIDDAKSPIETSNLEDKSILDTRLEEAINDIHDEYDKFIHGMKDKVDKSS
ILEDTLMKKISEQNKLIQKISDLYSTQNTSSKIQRGNDENRSLKFLKESEQQLNKTIDML
NEDILKKDKTITELKYKIENFQEVTSIENKLRKELDEEIKLGKIKEKNWENLADELETDI
NELEIAKKKLLNIIEQLNVDIEITKRESDDAISQLENQLHSMERKYNIMDIRHKESNSEH
DKLIAEIRLLEKEVKKWQEIANDAKSNSINIQKFDSEFNNFKEHLLLHMSNLLETFSKIL
QESSINQSEKKLQNIYKISGLAKIKLIQPRLESLYNFIETALESVVESYMALLLSENENY
EGGNKYIEVNKALELRVEELERKWISERERRKLDSNASEERIQKLEKENEMLRERLFNAS
MKS
Download sequence
Identical sequences A7TPP6
tr|A7TPP6|A7TPP6_VANPO 436907.A7TPP6 XP_001643606.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]