SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TPX0|A7TPX0_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  tr|A7TPX0|A7TPX0_VANPO
Domain Number - Region: 121-222
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00366
Family LacY-like proton/sugar symporter 0.066
Further Details:      
 
Domain Number - Region: 264-304
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0293
Family TTHA0227-like 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TPX0|A7TPX0_VANPO
Sequence length 458
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1008p4
Sequence
MSLFDSLQTMFENPNIPWKSIIIAFSVGQFAFESYLTLRQYNVLSSKKLPPVLQNEVDNE
TFEKSEKYAKAKAKFSIFTDIFALTQKLIFINYDLFPRLWNFGVQLTHYLPERFVAVSAI
PQSLVFLCVLSSLSTIVDMPLSYYQHFVLEEKFGFNKQTVKLWLTDIIKGNLLGVALGGP
ILYLFLKIFDKFETNFLWYICLFMFGIQILAMTVIPTYIMPLFNKFTPLEDGELKTSIEN
LAKKVDFPLNEIYVVDGSKRSSHSNAYFTGLPFTSKRIVLYDTLVNVSSVEEITAVLAHE
IGHWKKNHIIEMLVFSQVHIFAIFTLFTGVYRNVSFYKDFGFSVGNVDSSLLSSTSKVFT
SQFPIIIGFMLFNDLLTPMECGMQFVINLLSRHNEYEADQYAKNLGHSEKLCSSLISLEM
KNLATMNVDPLYSKYHYSHPHLAERLTALGYVSEKKKE
Download sequence
Identical sequences A7TPX0
436907.A7TPX0 XP_001643526.1.22633 tr|A7TPX0|A7TPX0_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]