SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TPX8|A7TPX8_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TPX8|A7TPX8_VANPO
Domain Number 1 Region: 89-149,187-308
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.79e-39
Family G proteins 0.00000484
Further Details:      
 
Domain Number 2 Region: 307-421
Classification Level Classification E-value
Superfamily Translation proteins 2.12e-37
Family Elongation factors 0.0000259
Further Details:      
 
Domain Number 3 Region: 422-518
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.93e-30
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TPX8|A7TPX8_VANPO
Sequence length 527
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1008p14
Sequence
MTDFQDREPTIIINGNLDVEEDVVYEHDVEMELDSAVQEEEEEEEKPKKKVMFTGVDEEA
DEEQRKREFEEGGGLPEQPENPDFTKLNPLSADIINRQATINIGTIGHVAHGKSTVVRAI
SGVQTVRFKDELERNITIKLGYANAKIYKCQNPECPEPDCYRSFKSDKEIHPKCQRPGCD
GRYELVRHVSFVDCPGHDILMSTMLSGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMK
LKHVIILQNKVDLMREESALEHEKSILKFIRGTIADGAPIVPISAQLKYNIDAVNEFIVK
TIPVPPRDFMISPRLIVIRSFDVNKPGTEIDGLKGGVAGGSILNGVFKLGDEIEIRPGIV
TKDDKGKIQCKPIFSNIVSLFAEQNDLKFAVPGGLIGVGTKVDPTLCRADRLVGQVVGAK
GHLPSIYTDIEINYFLLRRLLGVKTDGQKQAKVRKLELNEVLMVNIGSTATGARVVAVKA
DMARLQLTSPACTEVNEKIALSRRIEKHWRLIGWATIKKGTTLEPIA
Download sequence
Identical sequences A7TPX8
XP_001643534.1.22633 tr|A7TPX8|A7TPX8_VANPO 436907.A7TPX8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]