SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TPZ2|A7TPZ2_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  tr|A7TPZ2|A7TPZ2_VANPO
Domain Number - Region: 354-485
Classification Level Classification E-value
Superfamily Tropomyosin 0.000275
Family Tropomyosin 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TPZ2|A7TPZ2_VANPO
Sequence length 538
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1008p29
Sequence
MTGNIVYTQINDENIPDSSASLTDNDIIVTPIFEVKKENSDLEEAKADYIKKSMQRNSNK
NLEKMVVKEKNPKIRFDCNRILIFDQDKEVSKSGIQKILTKSSSSQKSILKKREDDIEDK
LYPQDDEITQIVKRMFTLCGVNLKHIEGISFKEQLERLSVSITNAFNTKEMCSKYIKQKL
ESQLNDKILEQQETVKYWKNLFDESTVRLKELEKSQIQMASGKLKETVQEQQKLAELNSS
LKNELAETKLVLKEAKCNLEFTRAKLIEFDNNNSAYRTDLQKNKKTLKAMEDRIKEKEEK
IRELGDSEEKFKKCNKKLSANCEILEQKVSALNVQNILLSEMNETFTQTNSETLKRLQVT
EFESENIKNEFDKTKSELTSLKKKLSKANKKIVSKEVDLKNLRQDNELTQDKLIEVNQEL
GVLKMKYCQLSKDIEEKIGEISYLKRENAGLSRIIENLQDRYTKSERQNKLQRTKYEELY
LENQKVNEVVSKSNKIFNGLLLKNHNGDNILETGIEAKKACLKPLKINVPHNKEILAQ
Download sequence
Identical sequences A7TPZ2
tr|A7TPZ2|A7TPZ2_VANPO 436907.A7TPZ2 XP_001643548.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]