SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TQ46|A7TQ46_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  tr|A7TQ46|A7TQ46_VANPO
Domain Number - Region: 51-134
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0196
Family Calcium ATPase, transmembrane domain M 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TQ46|A7TQ46_VANPO
Sequence length 391
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1006p10
Sequence
MVIDLLVRAVEESTNDPQVPVCAANNEYNGDLNLRILSVFMILISSAIGSFAPLILSNTK
MFNVPSWFFFIAKFFGSGVIIATSFIHLLSPATDALSNDCLGPGFTDYPWSFAIALISLF
VLFFVELIVYHYMSKADRLLQSPDVHYHKHSSMNSHGCTDDQSDLASKKSKNIEKVNEDI
ESCNINDNQDEINTNFNPMLGKDHFSHKDTHQDRNPSNPPLNNTDEGFYNQLVAVLFFES
GIVFHSVFIGLSLAVAGSEFKTLFVVLVFHQMFEALGLGARLVEVEWKKDKRWMPWLLAL
GFSLCTPIAIAIGIGVRNSWTPESKGALITNGIFDSISAGILIYTGLVELIAHEFLFSNQ
FKNPNGFKQMMLAYFVMCIGAGLMALLGKWA
Download sequence
Identical sequences A7TQ46
436907.A7TQ46 tr|A7TQ46|A7TQ46_VANPO XP_001643472.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]