SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TQ57|A7TQ57_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  tr|A7TQ57|A7TQ57_VANPO
Domain Number - Region: 9-111
Classification Level Classification E-value
Superfamily Tropomyosin 0.051
Family Tropomyosin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TQ57|A7TQ57_VANPO
Sequence length 478
Comment Tkp3 protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_483p5
Sequence
MTDTASANNIKGRLNNLEGQVQKMQGQVQEMKGQMHDILQEMSKMSSSLEQLIDMLKTQG
HHEEIHAKTLEQASIHSSNLQRNEDTIVNNKTRLERLEVSMEKRLIQIEERIMTGTPTTT
TGNNLESKLPPSNEILAQVRKYFPSLVIYENHSLLKSCIKAYSDVSLVVTREVILKDDDL
EDPVRTLMAIQGLLVGKRIRFQDWGKFLYSCCQDIGRFYLTNEQGINVDWTTAIFKLFEY
FDFNAKTQKGLSEVSNFNPEMGEEARDYFVKLIRKGKAVRGASALAIVVTKIHDILMYEN
SLIPRPKITDIHNFVELLSYVKDNVPSGIILDGEYGNTASSPLFAIQGSESSSNPGSNSG
FATAAYFCTKCQRISYPSTIKPYMEEELYSECDCDRSSSRLRGSKKSNVADLKDDILKME
EHHIAINSEFFDDSELDSETEDPYYDRPYTFENLDAIDFVLGPSVVRVTSLNASHPKK
Download sequence
Identical sequences A7TQ57
436907.A7TQ57 tr|A7TQ57|A7TQ57_VANPO XP_001643444.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]