SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TQ84|A7TQ84_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TQ84|A7TQ84_VANPO
Domain Number 1 Region: 18-263
Classification Level Classification E-value
Superfamily Pseudouridine synthase 4.73e-76
Family Pseudouridine synthase II TruB 0.0000024
Further Details:      
 
Domain Number 2 Region: 265-346
Classification Level Classification E-value
Superfamily PUA domain-like 1.82e-22
Family PUA domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TQ84|A7TQ84_VANPO
Sequence length 470
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_487p9
Sequence
MSTDYVIKPESVEPSSDTSEWPLLLKNYDKLLVRSGHYTPIPAGASPLKRDLKSYVSSGV
INLDKPSNPSSHEVVAWIKRILRCEKTGHSGTLDPKVTGCLIVCVDRATRLVKSQQGAGK
EYVCIVRLHDALKDEKDLGRSLENLTGALFQRPPLISAVKRQLRVRTIYDSNLIEFDNKR
NLGVFWASCEAGTYMRTLCVHLGMLLGVGGHMQELRRVRSGALGENDNMVTLHDVMDAQW
VYDNTRDESYLRKIIQPLETLLVGYKRIVVKDSAVNAVCYGAKLMIPGLLRYEEGIELYD
EVVLITTKGEAIAVAIAQMSTVDLATCDHGVVAKVKRCIMERDLYPRRWGLGPIAQKKKQ
MKADGKLDKYGRVNENTPSEWKKEYVPLDNAEPTAAPLIKEVEVEEKTVEEKTIEKSEEK
EEKEDKKEKKEKKDKKDKKEKKEKKEKKEKKRKSEDDGESEKKKKKKKSE
Download sequence
Identical sequences A7TQ84
XP_001643434.1.22633 436907.A7TQ84 tr|A7TQ84|A7TQ84_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]