SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TQA3|A7TQA3_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TQA3|A7TQA3_VANPO
Domain Number 1 Region: 9-459
Classification Level Classification E-value
Superfamily L-aspartase-like 2.2e-104
Family L-aspartase/fumarase 0.00000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TQA3|A7TQA3_VANPO
Sequence length 482
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1042p16
Sequence
MSDFDKYTTPLSSRYASEEMSAVFSLRNRFSTWRKLWLNLAIAEQELGLTVISDEAIEQM
RNNLTITDEEIAKASVQEAIVRHDVMAHVHTFGETCPAAAGVIHLGATSCYVTDNADLIF
LRDAYDIIIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDL
RNFVRARNDIGLRGVKGTTGTQASFLALFHGDDDKVEALDKRVVELLGFDTVYPVTGQTY
SRKIDIDVLAPLSSFAATAHKMATDIRLLANLKEVEEPFEKSQIGSSAMAYKRNPMRCER
VCSLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPGAFLTADILLSTLLNISSGLV
VYPKVIERRIKSELPFMATENIIMAMVETGASRQEVHEAIRVLSHQAAEVVKVHGGDNDL
IERIKGDSFFEPIWGKLDALLEPSTFVGRAPRQVENFINKDVKNALEPFQKYINDQEVKL
NV
Download sequence
Identical sequences A7TQA3
436907.A7TQA3 XP_001643415.1.22633 tr|A7TQA3|A7TQA3_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]