SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TQB6|A7TQB6_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  tr|A7TQB6|A7TQB6_VANPO
Domain Number - Region: 517-612
Classification Level Classification E-value
Superfamily Tropomyosin 0.00206
Family Tropomyosin 0.0045
Further Details:      
 
Domain Number - Region: 337-447
Classification Level Classification E-value
Superfamily Tropomyosin 0.00327
Family Tropomyosin 0.0035
Further Details:      
 
Domain Number - Region: 640-718
Classification Level Classification E-value
Superfamily Tropomyosin 0.0105
Family Tropomyosin 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TQB6|A7TQB6_VANPO
Sequence length 795
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_479p3
Sequence
MDSFPTTPVNKMILGHQETSDLGSTSNGNDGEFKVHPHGLSSKKRFVHSGVESASETDLS
LDCVRRSVNPETSEKARKEILDNMDINKLFSKSRDVSSADDISNGPMIKLIHSPVKVDLS
SPVPVTANGIDKAENEEHVSKKPRLELDFAPDLKKPITNDSEEIVGSPDAIEMIETKSSP
NKTGQNEELLALEIQEAMRVSIHEEESEDDKEDNNSKDVSHKSFVTPKKDDVETSPNLHK
LTPLLSSSSSSLSPKMEYRHICSGEQDEIEKEHNGFILVSRRNEELIDQLHMMNKRLNNY
LSKYENSNYQYKLLRAEHEKAKDNFEKQLNLAQAEVDQSTEDANKHKERFEKIKKKLSET
KDEIQMLNQNQRILQDKYDGMANEVDEWRNKYEEVQGKMAKQENEANNSASKLQLLEDEL
EILKNKLDEYEASETKLKLDYKELDELFQKREEELFSKANEVNTLQQSLNEIMNSQKSAS
EDLVKQIEELSTSKSQLEVKLSQISVDHSKEKHYLEDKINGMEKDLSENVGKLEIANQKI
SDLQIKLNGEIQNLANLKKEYEVSNDDAEINKAEVQQLNTNIEELKESEIHLKEKISTLE
ANIEEWKGKYQAQSSAHEKVSIEFESLQLKNNNIEAEHLAELEQLHDNMTSLQDTMKENA
ESINKLKDENRILQEKLLANEEVTSNSQTSSEVKEQEINELKNKIKDFQEKLDLKEQDTN
KRLKLLAEDLYVQYSSKHEQKVKLLKKGYDTKYQSKIDQISLQNQGLVQEIEQIKNQLST
ERKEKQKLLELLDQK
Download sequence
Identical sequences A7TQB6
436907.A7TQB6 tr|A7TQB6|A7TQB6_VANPO XP_001643373.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]