SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TQE9|A7TQE9_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TQE9|A7TQE9_VANPO
Domain Number 1 Region: 1-41
Classification Level Classification E-value
Superfamily Zinc domain conserved in yeast copper-regulated transcription factors 4.32e-17
Family Zinc domain conserved in yeast copper-regulated transcription factors 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TQE9|A7TQE9_VANPO
Sequence length 341
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_467p5
Sequence
MVLIDGVKYACQRCIRGHRVSTCNHVDQPLTVIKPKGRPSTTCNHCKTMRQNHNINPTGK
CECGKQLKSPKNRRRRTKSTKSLNGETSSGLLSPKSIIGNTTITTTTPSINNDNNNNNNN
NNNNNNNNNNNYNNNNKRNCDCQTGQICRCHNTRAKKRTSIASPLMENRRDSSTSILSSF
SNSNISRDNSGLLDMFKIKDSSISLANSLLNGGFEGEQYDSNVGSRTSSVVNDQVFIPKV
EILSLTPDFIDFLNPENLLKNNENINIDTNYLENIQNNDPDLNLMPLTPLDGTIITSTNP
NESTETVSPKDDKLIPNDMGIVFNWNFQDLDNLEDIKNSTS
Download sequence
Identical sequences A7TQE9
436907.A7TQE9 tr|A7TQE9|A7TQE9_VANPO XP_001643351.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]