SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TQJ6|A7TQJ6_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TQJ6|A7TQJ6_VANPO
Domain Number 1 Region: 56-159
Classification Level Classification E-value
Superfamily L21p-like 1.16e-19
Family Ribosomal protein L21p 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TQJ6|A7TQJ6_VANPO
Sequence length 162
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_463p9
Sequence
MFKNIIGLVNPSRASLISRTGGSFCNLKNFHTSSFLRQETSLIKENLSNLKLSNELYAVF
KVHNRPYLVTKGDIVTLPYKVKAAEVGDTLVLNDVTTIGSRNYKLIDYPIDPSLYTLRAT
IVEKTKRAFQVREITKQRQRRVRHAKSKGDLTVIRISELKMN
Download sequence
Identical sequences A7TQJ6
XP_001643318.1.22633 tr|A7TQJ6|A7TQJ6_VANPO 436907.A7TQJ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]