SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TQL6|A7TQL6_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TQL6|A7TQL6_VANPO
Domain Number 1 Region: 93-200
Classification Level Classification E-value
Superfamily GINS helical bundle-like 1.1e-30
Family PSF2 C-terminal domain-like 0.0027
Further Details:      
 
Domain Number 2 Region: 11-90
Classification Level Classification E-value
Superfamily PriA/YqbF domain 0.00000000000209
Family PSF2 N-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TQL6|A7TQL6_VANPO
Sequence length 216
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1027p11
Sequence
MSLPAHLQETFSPEEIQFIVENEPIKIFPRITTRQLARGRVGSVSDKSSSNQWRLITTDA
NNLNNMVAMQSTEVTLWLALLLKQQNKCSIIAPKWLTIKELDKSIQYEKKYLDRFSSIPW
NWLVLCQLLFKRASDDFHDPVHELRSRIQDLREIRQLKVLKGLKHLNNSHLQLDNISILE
INELRPFIVGIMDKLREIHSASESNDSSQANEDIDI
Download sequence
Identical sequences A7TQL6
436907.A7TQL6 tr|A7TQL6|A7TQL6_VANPO XP_001643295.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]