SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TQR4|A7TQR4_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TQR4|A7TQR4_VANPO
Domain Number 1 Region: 479-689
Classification Level Classification E-value
Superfamily Smc hinge domain 1.29e-44
Family Smc hinge domain 0.00065
Further Details:      
 
Domain Number 2 Region: 1-218,1072-1157
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.17e-43
Family ABC transporter ATPase domain-like 0.0003
Further Details:      
 
Domain Number 3 Region: 750-882,971-1163
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.26e-26
Family ABC transporter ATPase domain-like 0.00038
Further Details:      
 
Weak hits

Sequence:  tr|A7TQR4|A7TQR4_VANPO
Domain Number - Region: 295-505
Classification Level Classification E-value
Superfamily Tropomyosin 0.00015
Family Tropomyosin 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TQR4|A7TQR4_VANPO
Sequence length 1171
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1063p20
Sequence
MKVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAS
NLQDLIYKRGQAGVTKASVTIVFDNSDKSNAPIGFESSPTISVTRQVALGGTSKYLINGH
RAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTEILSLIEEAAGTKMFEDRREK
AERTMGKKEAKLQENRTLLNEEIEPKLEKLRSEKRIFLEFQETQKDLEETHRVVSAFDYN
YLVQKQTSVVETLQTSENRIIELKELITKVTDELGSLNEDLEQIQVQKKNELDKNGKLAK
LESNESKLMNEISRLKTSYKISEDNLSDTLSKLKSKGKNLEANKQELSNKSKMFEKIEEE
YKGINIQLDEYKQTYKKKEELLSTLSTGISSTGGTDGGYSAQLNNAKTKLNEANVSIKKS
NIKIEALQRELASNEPKMESAKKDLEISLKQIKQYEEQCSQIQLKIKEHGYDAETVKELK
QKKIAIEQQLNKIERENEYLKRKVANIDFTYTKPTGDFQEQSVKGVAARLFHLNENNYSS
ATALQVCAGGRLYNVVVDNEKTASQLLQRGRLRKRVTIIPLNKIMARKLNDKTLNIAKEI
SPGNVELALNLIGYEEDVAKAMEFIFGSSLICKDAETAKKVTFHPQVRTRSITLQGDVYD
PEGTLSGGSRNMNSSLLVDIQKYNEASKQTYVLQEELSVIQERLVALERVYEGTRVLQNE
YNLLKHKLRLAQRNLDSNSSTQVMKRNEEIYQELAVCNNEITTNNELVLKFGNEIKQIER
DMKEFSKDKGSKLKELKNELESLGKQIENQEVIAESKSDLFQNLQLETEQLSNEIQADEH
YIEQTSVSKKSLEEELETISTQLKEIENELQLVQDQLSEEKKRLLDIDEEAADLANIIKS
KSEIKSNSELELQKLTHDLTKFKNSTSGINEKIKQLADENEWLSDETFVAGIIKQNKGID
IESYRERNEQLLGRFNDMKRKVNPNIMAMIENVEKKETALKTMIKTIERDKVKIQETIEK
LNEYKRDTLIKTWTKVNEDFGNIFADLLPNSFAKLVPSEGKDVTEGLEVKVKLGSIWKES
LVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFI
VVSLKEGMFTNANRVFRTRFQDGTSVVSVMQ
Download sequence
Identical sequences A7TQR4
tr|A7TQR4|A7TQR4_VANPO 436907.A7TQR4 XP_001643267.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]