SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TQS9|A7TQS9_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  tr|A7TQS9|A7TQS9_VANPO
Domain Number - Region: 567-611
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 0.0272
Family Domain of the SRP/SRP receptor G-proteins 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TQS9|A7TQS9_VANPO
Sequence length 883
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_460p13
Sequence
MELESQSALTQEFQKLLLNTNSSSKRGLEGNKKNKTSTSNENGGLIIEEDLFQLDTETFD
KWVPLIRKAVERDELNPVVDELYNSIDENFQGLENQILQESQINDKMKISIGQISTIQGI
IEGSLTKEIVDLQEHLSLSTNDVIRKKQIYVNNKKTSLKISETTIVISKVLRILELANNC
QELIVEKDFFKALQNLDNLEKIYLQEFKNYNFQFLKELYDSIPFLKSSIKDECINLIRNS
FNLNLGKNLSKVGDSFFKVYRYELLPKWLETRDSMKLGNFNFNSPIEISLREQSTLEKLD
LRLFFHLDEFHDSILIFKSLDKLDYLFTELTNEYAFRKNKIIYPLSWKKSPHSIAADPLN
NNPINDEFSQQISVEFLKEYFLKILGFLLYDINLNRETDYIIVNNNLNATNEFWDGLMHR
LIPYLKQFINHNLNTDEELVEFKDFMCIYISILENYALNTEPLYNCLVSVFEKYCHLAVE
SFRSEFEILLNDDDFMPLTIQDRSLYEKVIKICWMKEDDEVLSDNQNLSEFSVTLPFSPL
YPMTCTLIKKTYSKLTAFISNHFRHELHRLNSILVKTVDSLFNNVVNQKIRDKLDTTSRE
EIAQILINLDYFIIAANEFSKLMARENIMQNPDIEIRLSSIKQYEDSRKYAESKLITLID
TKISDILETVSLDWESNDLRDDPDFSIVDIAQFLEMMFSSTLMNLPYSVQTLLIFREFDS
LTTKFLEMLLNETPDHITKESVMNFEVDMNYLKRIIPRIFPSEDEDYEDSLHPPQTPVSQ
TNFSSPSSSLIENNIKSLEATFTDLNQCIDLLKSGSFEEYSDPEIRMRKYARIRPEDATQ
LLKKVQAPPPIISSPNTSSSSHGSSSPREALNGRRIAKFFNRT
Download sequence
Identical sequences A7TQS9
tr|A7TQS9|A7TQS9_VANPO XP_001643236.1.22633 436907.A7TQS9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]