SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TQU7|A7TQU7_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TQU7|A7TQU7_VANPO
Domain Number 1 Region: 12-173
Classification Level Classification E-value
Superfamily Cyclophilin-like 0.00000000000139
Family Cyclophilin (peptidylprolyl isomerase) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TQU7|A7TQU7_VANPO
Sequence length 312
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_457p6
Sequence
MSVNLEPQTTAKCIIYTSKGNLNVELWAKECPIASKLFIETCLSKFWVGSSLGEFGEDGS
KLYIDFDGDTKFKDSIAMESNSRLLFNREGLLGWDIDAGLWFVTTSEKCDGKRKILIGKI
VDQTIYNFREICNGEKSKKNSNKFLYPADITDIEVTIPYFKDLEGNTTPVASNFNSSAKK
VQKSLKRAVKLKMDYTEEDYEDEDDDGSISLPVPKKMKIKLPKSIVIDQTKESTIEITPA
KDNSETPQEVPKTYQDNPDDEETRTSNDGGQLLIDTDTKSERELETLKLFEQFRNKIKGK
KILNRGNKNPGI
Download sequence
Identical sequences A7TQU7
436907.A7TQU7 tr|A7TQU7|A7TQU7_VANPO XP_001643213.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]