SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TQV6|A7TQV6_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TQV6|A7TQV6_VANPO
Domain Number 1 Region: 2-122
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.88e-30
Family Chaperone J-domain 0.00026
Further Details:      
 
Domain Number 2 Region: 266-352
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.83e-20
Family HSP40/DnaJ peptide-binding domain 0.0000188
Further Details:      
 
Domain Number 3 Region: 188-262
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.0000000000209
Family HSP40/DnaJ peptide-binding domain 0.0000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TQV6|A7TQV6_VANPO
Sequence length 357
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_457p15
Sequence
MVKETGLYDLLNVSPTANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDAEK
REVYDQYGLKAARGEAPQFANGGAGGFPGGGAHTFTNDDAFNIFSQFFGGNAGGQNANFN
FGGMPSGMGGMPRSSRSSYTNFGGMGGMPGGMPGGMPGGMGGGMGGMGGMPGGFGGSPRE
SQPEEVVQVDLPVSLEDLFEGKKKTFKIGRKGPNGEAEKAQIEIALKAGWKAGTKITYKN
QGDYNPSTGGRKTLQFILKEKPNTNFKRDEDNLIYTLPLTFKESLLGFQKTIKTIDGKTL
PISRVQPVQPSECTTYPGQGMPISKSVGQRGDMIVKFKVGYPTSLTEDQKRVINENF
Download sequence
Identical sequences A7TQV6
tr|A7TQV6|A7TQV6_VANPO XP_001643222.1.22633 436907.A7TQV6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]