SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TQW2|A7TQW2_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TQW2|A7TQW2_VANPO
Domain Number 1 Region: 484-680
Classification Level Classification E-value
Superfamily Smc hinge domain 4.71e-48
Family Smc hinge domain 0.00025
Further Details:      
 
Domain Number 2 Region: 4-181,1112-1200
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.2e-39
Family ABC transporter ATPase domain-like 0.00000045
Further Details:      
 
Weak hits

Sequence:  tr|A7TQW2|A7TQW2_VANPO
Domain Number - Region: 675-899
Classification Level Classification E-value
Superfamily Tropomyosin 0.000438
Family Tropomyosin 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TQW2|A7TQW2_VANPO
Sequence length 1221
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1011p5
Sequence
MGRLLGLELNNFKSYKGVVNVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVQSSHLRSN
VLKDLIYRGFLSGDDEDNNNEDVNPNSAYVKAFYQKEDVTHELMRSISNSGDSTYKINNK
TVSYKQYTSFLEDENILIKAKNFLVFQGDVEQIASQSTTDLTKLFEEVSGSIQYKKEYEE
LKEKVEKLSQSTAESIKNRRRINNEIKVYKDGITKDEKYKAQLEKRRNLLVYSSLWQLYH
LDEKKSQSKNKLKEAKSKVSKLKEKLANEEKILQKAKNSIVKDTAAITKYKNKLEYRSKE
KEKLASQLIPIKVSQRNTTKKISNIERRIEGIERDIERQKSYVERYESQLKVVTKSKESF
ELEIKESAKNFDKYRLSDEDLVTYDALSEKYLSSGGFDIDTKISLLNNDKQETSDEVAMF
KNRIELAKSKIADDLVLQGERLELEISELTSSLNEKNSLHSQKVSELKTLQGEIESTSNK
EYDLNYKLRETLVKLDDLSASQRESTNERKLRENVSMLRRLFPGVRGLVSDLCQPKKEKY
ALAVSTILGKNFDSIITDNISVAQECIAYLKKQRAGVASFIPLESIESEVPTLPFSDGQG
CILTINAIEYEPEYERAMQYVCSDSIICDTLTIAKDLKWKHNVKSKLVTLEGALIHKAGL
MTGGILRDATNRWDKEEFQSLTVLKDKLLSQIEELSTSSKSFAIKGRDLESTISLLNTDI
TSLRSEFTQLNRALEENKVEIQYQTDMIDKEFGPKLDALNDKIKVYDEEISQFENKKEDL
QGEIFKEFTNRLGFTIKEYEEHSGEIRRKQAKELQQLQRQILNIENKLQFEQERLASTEK
RFEKGQSELQKTKISLDSLETEESELQTQIEEIDNELETQRTEIDEMQKALDSKLKDISF
IEDSLNEVSNSLEISKREKLGFNDDIEKVDLEKIGIYKNCKISGIELPITSAITLENLPN
DKIDNDTILISNEIEVDYDELPAEYKESGNEAVGQKIEKEIKDAEEKLMELQPNSKAVER
YDEAKDKFDEIDKETEGLKKKERKLLTQFVNIKKKRKELFEKAFEYVNEHIDPIYRELTK
NPNSSVELAGGNASLTLEDEDEPYNGGVKYHATPPLKRFKDMEYLSGGEKTVAALALLFA
INSYQPSPFFVLDEIDAALDITNVERIATYIQRHGNPELQFIVISLKNSMFEKSEALVGI
YRHQKENSSRIITLNLTNYVN
Download sequence
Identical sequences A7TQW2
XP_001643193.1.22633 tr|A7TQW2|A7TQW2_VANPO 436907.A7TQW2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]