SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TQW6|A7TQW6_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TQW6|A7TQW6_VANPO
Domain Number 1 Region: 53-153
Classification Level Classification E-value
Superfamily Chaperone J-domain 5.23e-31
Family Chaperone J-domain 0.00026
Further Details:      
 
Domain Number 2 Region: 210-285
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 1.83e-16
Family DnaJ/Hsp40 cysteine-rich domain 0.00035
Further Details:      
 
Domain Number 3 Region: 353-426
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.000000000000144
Family HSP40/DnaJ peptide-binding domain 0.0036
Further Details:      
 
Domain Number 4 Region: 184-224,290-351
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.000000000641
Family HSP40/DnaJ peptide-binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TQW6|A7TQW6_VANPO
Sequence length 495
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1011p9
Sequence
MLSGKVLQKLVFNNVPLKTSVGRCYSNGFTFKLNQFQKSGFHTTRVLCNSDSSFKDPYKT
LGVARSASQSEIKKAYYKLAKKYHPDINKEPDAEKTFHNLQNAYEILSDEDKRAQFDQFG
ASAFSQNAGPSGGSGGFNPFANGNGGGFGDFGGLNFEDLFGAAFGGGASGRSNGGFGSRV
NMVREYKGDTIEIIHNLSFKDAVFGVNNVSLTFNALDPCDTCHGSGLKKGENHKRRSCSY
CNGTGTQIHVRSGFQMASTCNHCHGEGTIIAFEDMCTKCHGDGVKLDAQKKINVNLPSSL
SDGDVIRIPGEGSFPNIAVPEEDKDRVKLSRGDLLVRIRVKPDPDYTIKNKYDIWSVKEI
PITTAALGGTITIKTIDDKQIRLKVMAGTQHDQVTSIPNMGVPRRNGLGRGDMKIQYKVV
IRKPSTEVETCLWEALADVSKDTTAKRTMSNSILSSNPEDTTKTNSKDSSTDVNTLKKIE
NFISETFKKIKGKKQ
Download sequence
Identical sequences A7TQW6
436907.A7TQW6 XP_001643197.1.22633 tr|A7TQW6|A7TQW6_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]