SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TQZ9|A7TQZ9_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TQZ9|A7TQZ9_VANPO
Domain Number 1 Region: 84-204
Classification Level Classification E-value
Superfamily GINS helical bundle-like 1.26e-22
Family PSF3 C-terminal domain-like 0.023
Further Details:      
 
Domain Number 2 Region: 2-56
Classification Level Classification E-value
Superfamily PriA/YqbF domain 4.77e-19
Family PSF3 N-terminal domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TQZ9|A7TQZ9_VANPO
Sequence length 206
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1038p8
Sequence
MYYDIDDILADSAEIPCKFNYDIPGLGYLEGNPGKQINKNTKIQLPLWLARILAIIGGDS
EGADENGDETNENDNLPFLEMQTPDFLSNKVINAIKTSPESLDLHSINSHFIELANKWIA
LFGDTDLANVIYDLTLARSIELNNHASSVALELASNKPDNSNKDSIYQDGNNINTPFLLS
MDEFEKKIYKKSHNSYKDTKKWLFEP
Download sequence
Identical sequences A7TQZ9
436907.A7TQZ9 XP_001643160.1.22633 tr|A7TQZ9|A7TQZ9_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]