SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TR41|A7TR41_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TR41|A7TR41_VANPO
Domain Number 1 Region: 555-860
Classification Level Classification E-value
Superfamily Aldolase 2.38e-75
Family HMGL-like 0.00000227
Further Details:      
 
Domain Number 2 Region: 104-374
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.59e-67
Family BC ATP-binding domain-like 0.0000029
Further Details:      
 
Domain Number 3 Region: 857-1030
Classification Level Classification E-value
Superfamily post-HMGL domain-like 3.3e-48
Family Conserved carboxylase domain 0.003
Further Details:      
 
Domain Number 4 Region: 19-132
Classification Level Classification E-value
Superfamily PreATP-grasp domain 7.19e-41
Family BC N-terminal domain-like 0.0000618
Further Details:      
 
Domain Number 5 Region: 355-473
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 2.67e-37
Family BC C-terminal domain-like 0.00012
Further Details:      
 
Domain Number 6 Region: 1092-1170
Classification Level Classification E-value
Superfamily Single hybrid motif 1.44e-19
Family Biotinyl/lipoyl-carrier proteins and domains 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TR41|A7TR41_VANPO
Sequence length 1177
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_461p4
Sequence
MVAAAQFGGLRDNHSLLGEKNKLLVANRGEIPIRIFRSAHELSMRTVAIYSHQDKLSMHR
LKADESYVIGREGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYGFLSENAEFAAKVIDAG
ITWIGPPPEVINSVGDKVSARNLAAKANVPTVPGTPGPIETVEEAKNFVKEYGYPVIIKA
AFGGGGRGMRVVREGDDIVDAFNRAKSEAVTAFGNGTCFIERFLDKPKHIEVQLLADNYG
NVVHLFERDCSVQRRHQKVVEVAPAKTLPIEVRNAILTDAVRLAKEAGYQNAGTAEFLVD
NQNRHYFIEINPRIQVEHTITEEITGIDIVAAQVQIAAGASLEQLGLLQDRIVTRGFAIQ
CRITTEDPSKNFQPDTGRLEVYRSSGGNGVRLDGGNAFAGAIISPHYDSMLVKCTCTGST
YEIVRRKMLRALIEFRIRGVKTNIPFLLTLLMHPVFINGDYWTTFIDDTPQLFKMVSSQN
RAQKLLQYLADLSVNGSSIKGQIGVPKLTTNPNIPLLHNREGDVIDVINTTPPSGWRQVL
LEKGPEEFAKQIRKFDGTLIMDTTWRDAHQSLLATRVRTHDLVTIAPTTAHALAGAFALE
CWGGATFDVAMRFLHEDPWERLRKLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQ
AKENGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATICYSGDMLQPGKKYNLDYYLEI
SEKVVKMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPELPIHVHSHDSAGTAVTSMATC
ALVGADIVDVATNSMSGMTSQGSINALLASLDGEINTNIDARHVRELDAYWAEMRLLYSC
FEADLKGPDPEVYEHEIPGGQLTNLLFQAQQLGLGEQWTETKRAYREANHLLGDIVKVTP
TSKVVGDLAQFMVSNKLNSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLR
NKRRKLTSRPGLELSPFDLEKIKEDLESRFGDINECDVASYNMYPKVYEDFQKMKERFGD
LSVLPTKNFLAPPVIGEEIEVTIEKGKTLIMKLQAVGDLNKDTGTREVYFELNGELRKIP
VVDKSQKVEAVSKPKADVNNPLHVGAPMAGVVVEVKVHKGSLVKKGQPIAVLSAMKMEMV
ISATAEGQVKEVFVKDSENVEASDLLITLENPEAEAK
Download sequence
Identical sequences A7TR41
tr|A7TR41|A7TR41_VANPO 436907.A7TR41 XP_001643109.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]