SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TR94|A7TR94_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TR94|A7TR94_VANPO
Domain Number 1 Region: 73-222,260-430
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.000000271
Family Reverse transcriptase 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TR94|A7TR94_VANPO
Sequence length 516
Comment Tkp4 protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_423p17
Sequence
MMVFDLQAGIPRNQVSKEKIIPVQTIFTVKRDGTHKARIVCRGDRQTPSTYGVINTDLLQ
MDTLKLLLMIANNNRMVVQTLDINHAFLYADLQEVIYIPHPYEPNKVVQLNKALYGLKQS
PKEWNDHLRKYLNDCSLFDTEYTPGLFMDKEKLIIIAVYVDDCIIAAKDNIILKRFINKL
KETFELKIVGTMDKGILKTDILGMDLDYNITKGEISLSLETYLTGIENDWIDELKYIKYD
NSPHWSSYNYKDDLIPILSESRKKEMTKKLQIMSGIINYILTRCRYDIAFAANKLARIVN
SPNEQSIKIAHKILKYLFTTKNQKLIYLRENGSKPIIEIITDASLGTEWDHKSRIGVMVW
YGRNLYKVISRATTSIRESSTEAELDAIYEGYKEGKLLKKVLETINISNNIKINIFTDSK
PGIQFLNKKYRSKKRDKFLDLKVAKLTEQVRENIIAIGKITGIFNVADILTKPVTTIQFK
KLVECLENKLHPGDILRISELGESESKDKKKMLMIS
Download sequence
Identical sequences A7TR94
436907.A7TR94 XP_001643085.1.22633 tr|A7TR94|A7TR94_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]