SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TRC6|A7TRC6_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TRC6|A7TRC6_VANPO
Domain Number 1 Region: 1-386
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.96e-116
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.000000000903
Further Details:      
 
Domain Number 2 Region: 389-509
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 2.94e-34
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.000028
Further Details:      
 
Weak hits

Sequence:  tr|A7TRC6|A7TRC6_VANPO
Domain Number - Region: 550-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0369
Family Classic zinc finger, C2H2 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TRC6|A7TRC6_VANPO
Sequence length 634
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1069p17
Sequence
MSKFKWRDLIQLNSKDEAYKSELCCLCHIDLNAFFAQVEQVRCGYTKDDPVVCVQWSSII
AISYAARKHDITRMDSIKDALKKSNNKLIPIHTAVYKKGEDFWQYHDGCGSWMQEASKQL
SPEQYKVSLNPYRREGRKIFKIFKDFCDLVEIASVDEGFLDISRLCLQQLLFEEDILEKC
KEDSEGKSLQERFIAGDYDLDSYLPPVPDTLKTLKFEGFVYDAEFGSLIDDWDDVIFALG
SQISQKIRNHVRDTLGYTTSCGIARTKTVCKLGSNFKKPDAQTIIRNKSITKFFDNGNIE
LTNFWTMGGKLGQNLIHILNLPTQGSIKALRERWDDPVEINKYMNERLLELNGNGEDFEM
DDDKKEAVTQKLFDLVRGQHCLPVNPRPIIKSMMSNKNLRGNSCKNIIDCMQWLDIFGNE
LADRVNELEQEYHKICIPKTISISVKTNEWKTYSKSSPLHCRGSNISSLDIIRTASKLIN
EFNLKYSNVPEPNFYPLKQFNVVISNFEILDMKKSVIEMIGNVKGDYSKKDLPESIPHAE
PRDTEVFIGNWKCQDCNIEFESESAFNEHNDYHVALRLSESLNGADVNSKNISEGERRLL
LSNKNRQVGYITKRKHNKDTNSTQKTNIFKFFKK
Download sequence
Identical sequences A7TRC6
XP_001643052.1.22633 tr|A7TRC6|A7TRC6_VANPO 436907.A7TRC6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]