SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TRR0|A7TRR0_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TRR0|A7TRR0_VANPO
Domain Number 1 Region: 247-503
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.58e-38
Family Lesion bypass DNA polymerase (Y-family), catalytic domain 0.00055
Further Details:      
 
Domain Number 2 Region: 82-178
Classification Level Classification E-value
Superfamily BRCT domain 5.5e-24
Family DNA ligase 0.065
Further Details:      
 
Domain Number 3 Region: 517-630
Classification Level Classification E-value
Superfamily Lesion bypass DNA polymerase (Y-family), little finger domain 0.000000706
Family Lesion bypass DNA polymerase (Y-family), little finger domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TRR0|A7TRR0_VANPO
Sequence length 880
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_367p9
Sequence
MNCDDDKISFLSSLDDDSLIQYVEHISQNGTTTYANDDAGNMDLNKNTNDDDLSKKQNPK
RKNYTRGDYFRDKRAKQAKQDKILLNNNKDKLKIFENCTIYINGHTNPDRLKLHELIVIH
GGKFLHFLSAKGSATHIVASKLPLKKKLEYANYKVVNPDWIMNSINAGKLLPWQEYSLVS
DVNFGQSKLKLKNLEIKNGDTSSVINCNDPSFIENYFKNSRLHHLSTWKSELRSNFVQDL
LSSNTRRKIQKEDTLKIFHVDFDCFFATVAALSVTDMAIDINKDAILVCHGSKNSDIASC
NYVARNLGIKNGMWVSRAEKLCPKGMKLICLPYNFEQIELKSKIFYNVLKELELFQLILP
ISIDEAICVISNPDPFIDLNGVCETIRNLVHQETGGCTVSIGCAESLILARLALRLGKPD
GYYVVNSNSDIANNVEFWKKFKITDLPGFGNATLNKLDEQFNIKDQNSLYNLQQLVINND
LKNILGNKTSEKLNLALKGLDDNESTKMIYDPDEVFKRKSLSMEINWGIRFENIGQVDVF
IDRCAKYLVDKLINMNSKIDQVTLKISRKAKSAPENPLKYMGMGLCDSFSKNSKLGLPTS
DIGIIATEVKSLFRMLSCPPTELRGVSIQFNKLIDTNDVDYRLKLPFKKIIVDDTFNKIP
EKLKPTIRKELNKREIAIFSSRTGSLQPKKQIDKKFSPTKEEEKFIQELPTQIRKEVIHD
LTIIKKAKHSKLDDVKESARKRENNFRQSKFHFQGKDSIFKQISFQGETSFKKISKLVTN
WINATLNDAGPHVKDVKLFEKYLIKLANTNRIHMVLSLVELVSNQLNLNSTNETLNVYNN
SVETGFQQWEQVLLNRMIPILNKNKHTFQTERKLNIEFNI
Download sequence
Identical sequences A7TRR0
XP_001642912.1.22633 tr|A7TRR0|A7TRR0_VANPO 436907.A7TRR0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]