SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TRR3|A7TRR3_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TRR3|A7TRR3_VANPO
Domain Number 1 Region: 440-553
Classification Level Classification E-value
Superfamily eIF1-like 8.11e-18
Family eIF1-like 0.0098
Further Details:      
 
Domain Number 2 Region: 363-422
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 0.0000000436
Family SWIB/MDM2 domain 0.0081
Further Details:      
 
Domain Number 3 Region: 91-173
Classification Level Classification E-value
Superfamily PUA domain-like 0.00000472
Family PUA domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TRR3|A7TRR3_VANPO
Sequence length 566
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_392p2
Sequence
MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE
EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS
RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK
RDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEESALTVEDI
DHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKFLKH
FEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRISNSSSNSGKKINSNRQESENMMYS
LVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDRLYD
MCYTKKSTNPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRIKIVTEM
KIGRKIVTRVSNFESFGIDADALAGDLRRLCSGSTTIGETTTSPKTTEVQVQGPHSKIII
DHLNSLSIPTKWIDFENKLKPKKIRN
Download sequence
Identical sequences A7TRR3
436907.A7TRR3 tr|A7TRR3|A7TRR3_VANPO XP_001642893.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]