SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TRS7|A7TRS7_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TRS7|A7TRS7_VANPO
Domain Number 1 Region: 206-305
Classification Level Classification E-value
Superfamily PUA domain-like 0.00000000323
Family LON domain-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TRS7|A7TRS7_VANPO
Sequence length 397
Comment Putative uncharacterized protein (Fragment) OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1007p5
Sequence
MIRCRNSVVRKVLKGKLFCSGQCLQNRLGLRYASSVDVSSMERHPSLSMGEEHHWKMYKE
QLKDVTLQQRLKSLEDQWFEQKLFADKSENDNEGSGLDLPKDKSGKKNVPKRKDDTSKSI
PEDQQKQKKKVPTEEENNTTTTEINESTTENITSEKVSASNPTSSVPPSNSNGDGDGNGN
NDGGNGKNQQKKLITVPKIYPQMLGLPLSRRPLFPGFYKAVVISDERVMNAIKEMYDRQK
PYFAAFMLKDSNMETDIIENVKDVYETGVFAQVTSIFPSTDEKTGATVMTALVYPHRRIK
IDELIPPVHPKVQDTQADEKTDSKLSSKTPEDSSVETSIVDEIDVIDNEGIVSKTSEELI
EEEEEEDESNPTNFLKKFDVSLVNVSNLEDEPFDRKS
Download sequence
Identical sequences A7TRS7
tr|A7TRS7|A7TRS7_VANPO 436907.A7TRS7 XP_001642879.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]