SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TRY7|A7TRY7_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TRY7|A7TRY7_VANPO
Domain Number 1 Region: 194-352
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.82e-24
Family Retroviral integrase, catalytic domain 0.058
Further Details:      
 
Domain Number 2 Region: 856-1005,1043-1211
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000756
Family Reverse transcriptase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TRY7|A7TRY7_VANPO
Sequence length 1289
Comment Tkp4 protein (Fragment) OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_414p5
Sequence
MDFKHSKNPPKLCGMENHPITIKGEGFLQIKIDNSNKTIKTKVYFCPYESATVLSIATLQ
EDTGYELERGYKFLTNNILRIKVSKVDKTLWINSNNLLVKNEIKNKTTSNKTVRVVTNKT
KKKVSIQEAHAKFNHIDKNVVKATIESGIFADVDGLKETSTEIAQYQCEDCLRGKLKTHN
HYTGSMNAHYVNVLPGASWSIDLRGPIVRSHKNVPHYLLVMVDNVSRYMMISTHLDKSSQ
SIPRQIIKNIHLIENQFDRKVKELITDRGTEFNNSVLKEFIDGRGIKWILTDTDDHASNG
RVERYIGVLNADLRTLMIQSQLPWKLWKYAAMAATDSRNTSLNKMTGQTPFNMISGNSEP
LLYKSLIPFGQKAFVKDHKKIKTGLQGLEALALCKDPESRGYYFYLPETRKIVTTSSFSL
LKAQTNHQHNEHDIAVHDDDIDMESLSDERDYNITIDSDVNNTDLSTDLSGTDETEEDEH
SSQEVEFTHENNESGQQEVELEKILDEVYEVPSQLRENRVDKIKEVHLDETTITDRTKSK
LSATPHIKPLSEKFYESEEEEEDSTVESVSSQEIPEDEIQSESVSSEEISEAEPSYELIT
PQEISEDEPQDEVITPQDTSEDEVTNESVPSREIPEDEPQQEEVSTFQVTGNEHQLMTGQ
VPETDKQESNNGQILFQPPVDNTESTDEEHSSHLQQRINNLLNKKFYSIQKPSTKRKSAL
YKQALRAHDFDEMKKNRPLQYEVPVVHTIRSMYYNEAITNNTNMKTRKLFQEAYQKELDN
LKRMLVFDIQMGIPRNQVPKEQIIPVQTIFNVKRDGTHKARIVCRGDKQTASTYGVITTD
LLQMDTLKLLLMIANNNRMVVQTLDINHAFLYADLQEVIYIPHPYEPRKVVQLNKALYGL
KQSPKEWNDHLRKYLNNCSLYDTEYTPGLFMNNEKSIIIAVYVDDCIIAAKNNIILKKFI
NKMKETFELKIVGTMEKGILKTDILGMDLDYDITKGEISLSLETYLKSIENDWIDEINYI
KFDNSPHWSSYDKKTKGIPILSEIRKKEITKNLQIMAGIINYILTRCRYDIAFAANKLAR
SVNTPNEQSIKIAHKILKYLFTTKDRKLIYRRETGSKPKINIVTDASLGTEWDYKSRIGI
MVWYGRNLYKVISRATTSIRVSSTEAELDAIYEGFKEGKLLKKVLEKLKILNNIDINIFT
DSKPSIQFLNKDYRSKKRDKFIDLKLAKLSEQVRENIIAIEKIPGVTNVADILTKPVTTI
QFKKIIECLENKLNPEDILHITELEESKF
Download sequence
Identical sequences A7TRY7
tr|A7TRY7|A7TRY7_VANPO XP_001642830.1.22633 436907.A7TRY7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]