SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TRZ0|A7TRZ0_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TRZ0|A7TRZ0_VANPO
Domain Number 1 Region: 185-215,254-467
Classification Level Classification E-value
Superfamily Aquaporin-like 7.85e-57
Family Aquaporin-like 0.0000808
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TRZ0|A7TRZ0_VANPO
Sequence length 602
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_388p1
Sequence
MKPSNQDESVKDSANNNNEEKVRDQNQSSANHHHHNSNHENFDYERQQEYNYQYSNLATT
YIPQYTIDGSYPIQEVVPNTQMAMSGADSAFNRDGDNASNLRQRAKTPVASNVLDVGDFY
RNADDGQANTNQQGEGNGYDDFSPDPRNVPLMVKPKTLYQNPQTPTVLPSTYHPINRWSS
IKHTYLKEFLAEFLGTMFLVIFGDAVSAQVGLGAKAQQDQFAKTLANLEAAGIITSDQIQ
IFTSFEDIINSQGAGTFDAIPFGWAAAVVMGYFAAGGSAISGAHLNPAVTVSNFIYRGLP
LKKVPIYIAGQLLGGFLGGLIVFAYYKKVIKETFPDWRSNQSVASMFCTFPQAYLSTARQ
VVSEFVNTAMFQASLFALTDPYTSLSTDIFPVMLFFLIYILNASMSYQTACAINLARDMG
PRLAIYVVGFKRALIWDFHHHYFWVPMIVPFIGATFGGLVYDICIYQGHESPVNWPLSIY
KEKFLRTWHRRPGWKARSRERATSELSDFSYNDNDSQIGDQKLKPARTRTKSNGSSADDS
KQKSVQFRPVQRGKGYGNGVPTILEEGDSIETASLGGASHASVMLTDGSSSPETVKDSNE
KN
Download sequence
Identical sequences A7TRZ0
tr|A7TRZ0|A7TRZ0_VANPO XP_001642816.1.22633 436907.A7TRZ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]