SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TSE4|A7TSE4_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TSE4|A7TSE4_VANPO
Domain Number 1 Region: 582-749
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.73e-33
Family Retroviral integrase, catalytic domain 0.0025
Further Details:      
 
Domain Number 2 Region: 1276-1466,1496-1678
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.89e-19
Family Reverse transcriptase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TSE4|A7TSE4_VANPO
Sequence length 1726
Comment Tkp5 protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_462p1
Sequence
MSQPDQQSNSVSIPPSMDTCSLLVSNLRQQVMSPVSNSKPIPVLLSGPQNYDIWLHYFMR
VVGRASHVWKEYVNTGDINSVRMEYPVTDNQINSILEDLDFNLINLINKSVSKEIEKTIE
ESFLSAKIDGPPGLLLLEYLRSKYGRKCVESSMSIFSELTSASSKPHPNKGNWAKRFIDA
IFDGNEDLDINNIFQDPAVRSAVKDYHRKLKDYASALLLMALTPELQQKFIDFFGPRISI
SYHDVENMIERQNSTVPSDTSSNAAAFVAQKKKFYNNNNGNNNGNSNNNYYKRKTVCKVC
KASHNTENCPEVQKLINKNDSSKKTITTNTNNNNNNGWNAGMLCYQQDTSDTDDDILWMA
VDVDGNCFNAKLPDPGYFAENDKATWILDTGCTSHLCCDLQLFENFKPSRSTNKITGVAG
NVPILGYGDVIMDNIKLQHVAYVPDLPANLISVRQATEVGGCEFIFNKSSVFMSSPSRKL
KKVGSVHKKLYVLDISTKAPEITELSFVAGSDPMLSTEIKPVSESIRWHSRFGHPGIEAY
NSLARTFSLPRMHPENITVCPTCSLGKGLIKKGGNSRTTYSSPLQLIQVDLCGNFRYKEY
RSNRYFMTIRDAYSRYYTVIHLNAKKDATQELIDWINRTENFFSSRGGHKVGSIRTDNGG
EFKNNVLHEYLISKGITHELTIPYSSFQNGAVERAHRTIEERTRCLLISGRVPPELWSEA
VSCAVYLINRTPVSAKKNIIPAALWFQVKSFTFNNLRTFGCAAYITLPPQLRDGKLSPTS
IKGVHVGYDSHHKGYRIYEIETGKIFVSRQVKFDENVFPLEGLSIDELPQKYATSPVNGA
PSYSSVTSGSSSYYPSGNVTALSPPPSSSSSSDSPNAENPDTDATMTNNSQEPSICQDNM
DTDTDDSPTNSLEDEQHLSSVLSHSSDLSFKPPSSIIMNNSTSDRITKRTRSETNVTFPV
SADEAIVETPFSPSQLSSEPPSSSGDNHTIEDLSTRRHLKSSPFTDDTIRTLEDKIRILE
RDSKQQSAIIASFRSRQKNSNESIATDIFDGTQSEFPATRFSKNRKVHLDDMNTDVGVGN
QLTTLDNQMITDVGFTPNTPFNPSMSVVTRPVADIHTDAIRAQLKSNPNSSFNSLPPTWF
PAGIPVGQIALPPPSSPLPIESTDSAADSPSVISQGYLTSSSDTPSVSPPNNASPLDFAL
FAVWLASSISQKTSQAPITIKQALYGPDGAEWRAACLKELSAFKEHKTFSLVPPPSDARS
LGTRWVFTIKDDGRKKARLVAQGFRQKEGIDYTETFAPVIRYDSVRVLLALACCLNLRIH
QMDVDTAFLNSQMEDAVYVKQPPGFIDSDPAHEGWVWKLHGGMYGLKQAPLLWNKHINRS
LTALGFTRNEKEFGLYFKQTADGPLLIGLYVDDLLIAAPSPRILSLTKQKLQELYSMKDL
GPVSKFLGMNITQFSNGNITLSLADYITKAAADQQTPLHKKVHIPLSPTINYFDDKSPVA
ENITAFQSIVGQLIFIANAGRPDIAYSVSLLSRFLKDPRVVHVSAAHRVMQYLYTTRFHG
LGYRAGSPLQLTVYSDASHGSLADMPFSTGGYVTRLAGGCVTWSSKKIKTTVCLSSTEAE
YIAASEAVKEIEWLCDLTAVMDFKLDKTRLYVDNEPAIKLSKNPVMHPRTKHIALRYHKI
RHAVEQDIVDLEYVNTKDQQADILTKVLAKYQFEALRDELVSKLTT
Download sequence
Identical sequences A4VB72 A7TSE4
XP_001642664.1.22633 436907.A7TSE4 tr|A7TSE4|A7TSE4_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]