SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TSJ9|A7TSJ9_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TSJ9|A7TSJ9_VANPO
Domain Number 1 Region: 46-522
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 9.42e-137
Family 2-methylcitrate dehydratase PrpD 0.0000000000438
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TSJ9|A7TSJ9_VANPO
Sequence length 525
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_354p5
Sequence
MIDLLKTRINVLSKISKNQRTVSNIIFKHTMSSSSPINSSNERPKTDTVISEISDYVMDK
KINSSLAFETAKLCFIDALGCGLAALKFDQAVKIIKPIVPGTIVPNGTRVIGTNLIYDPV
RGAFANGSLIRWLDYNDCWLAAEWGHPSDNLGGIISVADYLTRLYKSSDGEEGRLFTIND
VLECMIKAHEIQGVIALDNSFNKVGLDHVILVKVATTAVVAKMLGLTKDQCEEAISQAFV
DGQSLRTYRHAPNTGSRKSWAAGDAVSRAVNIAYLVKNANVGNIPSVLTAKTWGFYDVLF
KGKPFVFNQRSFYDSYVMENILFKISFPAEFHAQTAVEASMKVHQQLKDMGKTYADIKSV
RIRTQNAAVRIIDKSGPLYNYADRDHCIQYMVAIPLIHGRLTADDYSDGIAENPAIDELR
AKMYCVEDENFTQDYHDPEKRSIGNALLVELNDGTVLDEVEVEYPVGHRFRRDEGIPLLM
KKFERHLSEHFENNKDHVNKILEVTKDKDFLNMDVDKYIDLYVNQ
Download sequence
Identical sequences A7TSJ9
XP_001642615.1.22633 436907.A7TSJ9 tr|A7TSJ9|A7TSJ9_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]