SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TSM9|A7TSM9_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TSM9|A7TSM9_VANPO
Domain Number 1 Region: 186-275
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000000536
Family Calcium ATPase, transmembrane domain M 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TSM9|A7TSM9_VANPO
Sequence length 322
Comment Putative uncharacterized protein (Fragment) OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1075p2
Sequence
MSTNPFEDDTSKNPVSPFDDNFQFENDLSSGPHVNFDFEGNSRDRTAVNYDTDTGNGSDM
KDVKFDDGENDLSFEQGDTHSFEATPNIHRNSGTFEDITLQDDGNNRMKRLRWGTHRNKR
GNPNVGRAKTLRWAKKNFQQPFEEFIGMEDSLDDAVTKNRADELRTVYFNLPLPKDMLDD
DGNPITEYPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLVLIILGAFQIFGVTNPGFA
AVPLIVIVCITAFKDAFEDSRRTVLDLQVNNTKTHILEGVVNENVSADNVSSWRKFKKAN
SRLLFRFINFCKEQLTKEGKHR
Download sequence
Identical sequences A7TSM9
XP_001642581.1.22633 tr|A7TSM9|A7TSM9_VANPO 436907.A7TSM9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]