SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TSN0|A7TSN0_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TSN0|A7TSN0_VANPO
Domain Number 1 Region: 8-110,628-854
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.96e-36
Family Calcium ATPase, transmembrane domain M 0.032
Further Details:      
 
Domain Number 2 Region: 401-465,521-627
Classification Level Classification E-value
Superfamily HAD-like 1.23e-31
Family Meta-cation ATPase, catalytic domain P 0.053
Further Details:      
 
Domain Number 3 Region: 122-138,216-422
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 3.6e-19
Family Metal cation-transporting ATPase, ATP-binding domain N 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TSN0|A7TSN0_VANPO
Sequence length 1026
Comment Putative uncharacterized protein (Fragment) OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1075p2
Sequence
NFSVVSNLIVLFILCFIAGIVNGVYYSKGDKSRFSFEFGTIAGNASTNGFVSFWVAVILY
QSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKT
GTLTQNVMEFKKATINGVSYGRAYTEALAGLRKRQGIDVEAEGAKEKEEIARDRDTMISE
LKALSNNSQFNPDELTFISKEFVRDLKGANGEYQKRCCEHFMLALALCHSVLVEPHKSDP
NKLDLKAQSPDEAALVGTARDLGFSFLGKTKSGLIVEIQGVQKEFQILNVLEFNSSRKRM
SCIIKVPSSSPDGEPTALLICKGADSVIYSRLKRTDNANDDTLLEKTALHLEQYATEGLR
TLCLAQKEIPWAEYQAWNAKYDRAAGALTNREEQMEEVADAIERDLIILGGTAIEDRLQD
GVPDSIELLAKAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKASGEDTEQYGSDP
YEIVNVLISKYLLEKFNMSGSEIEIEEAKKHHDLPKGEYGVVIDGDALKLALSSDDLRRK
FLLLCKNCKAVLCCRVSPSQKAAVVKLVKITLDVMTLAIGDGSNDVAMIQSADVGIGIAG
EEGRQAVMCSDYAIGQFRYLTRLLLVHGRWSYKRLAEMIPAFFYKNVIFTLALFWYGIYN
NFDGSYLFEYTYLSFYNLAFTSLPVIFLGILDQDVNDTISMVVPQLYKVGILRLEWNQRK
FVWYMIDGFYQSVICFFFPYLIYHKTMLVTNNGFGLEHRYYVGTFIATIAVVACNLYILL
HQYRWDWFTGFFVGLSIMILFAWTGIWSSSLTSNEYFKSASRIYATPVFWGIMFVGVLFC
LLPRFTYDCFLKLFNPSDVDIIREMWKRGDFDNYPLGYDPTDPNKPKISQRGRFASVSHK
IEMSNFDDDILPSNNSHASIVTEEIPMNFMDRPDGTPMLVRKDKDSAWNDSPRETQDLLF
SPRADDSEEQSRVFSGRKSLDRRREEMLKTNQLDNRYSVERARASLELPGVTQAENLMEK
TEKYFS
Download sequence
Identical sequences A7TSN0
436907.A7TSN0 tr|A7TSN0|A7TSN0_VANPO XP_001642582.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]