SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TSP5|A7TSP5_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  tr|A7TSP5|A7TSP5_VANPO
Domain Number - Region: 160-211
Classification Level Classification E-value
Superfamily post-HMGL domain-like 0.0126
Family Conserved carboxylase domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TSP5|A7TSP5_VANPO
Sequence length 292
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_316p5
Sequence
MSDEIIWQVINQQFCSYKLKTDKGQNFCRNEYNVTGLCNRQSCPLANAKYATVKNVDGRL
YLYMKTAERAHTPAKLWQRIKLSKNYSKALKQIDEHLLYWNKFLIHKNKQRLTKLTQVAI
TERRLALREDERHYVGIAPKVKRREENRERKALVAAKIEKAIEKELLDRLKSGAYGDKPL
NVDEKIWKKVMGKMEEEVEEEEDMEEEEESDEGEIEYVEDEGDEELIDVEDIEKWLGDSD
SYSSDESSEDSSDEDSNDDESTKKKQTPKRKRPRVEIEYEEEQNTPAQQELA
Download sequence
Identical sequences A7TSP5
436907.A7TSP5 XP_001642570.1.22633 tr|A7TSP5|A7TSP5_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]