SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TSS7|A7TSS7_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TSS7|A7TSS7_VANPO
Domain Number 1 Region: 1-67
Classification Level Classification E-value
Superfamily PR-1-like 5.36e-25
Family PR-1-like 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TSS7|A7TSS7_VANPO
Sequence length 71
Comment Putative uncharacterized protein (Fragment) OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_282p1
Sequence
AWYDEIANYDYSNPGFSVATGHFTQLIWKDTTQVGCGIKYCGDYYGDYIICSYNPPGNYQ
GEFASEVEPLA
Download sequence
Identical sequences A7TSS7
436907.A7TSS7 XP_001642532.1.22633 tr|A7TSS7|A7TSS7_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]