SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TSW0|A7TSW0_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TSW0|A7TSW0_VANPO
Domain Number 1 Region: 12-452
Classification Level Classification E-value
Superfamily Amidase signature (AS) enzymes 1.18e-103
Family Amidase signature (AS) enzymes 0.000017
Further Details:      
 
Domain Number 2 Region: 711-978
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.83e-65
Family BC ATP-binding domain-like 0.00000679
Further Details:      
 
Domain Number 3 Region: 613-741
Classification Level Classification E-value
Superfamily PreATP-grasp domain 8.34e-44
Family BC N-terminal domain-like 0.000043
Further Details:      
 
Domain Number 4 Region: 959-1070
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 9.94e-34
Family BC C-terminal domain-like 0.00026
Further Details:      
 
Domain Number 5 Region: 1257-1381
Classification Level Classification E-value
Superfamily Cyclophilin-like 8.34e-26
Family PH0987 C-terminal domain-like 0.016
Further Details:      
 
Domain Number 6 Region: 1550-1679
Classification Level Classification E-value
Superfamily Cyclophilin-like 6.45e-23
Family PH0987 C-terminal domain-like 0.0034
Further Details:      
 
Domain Number 7 Region: 1756-1829
Classification Level Classification E-value
Superfamily Single hybrid motif 4.45e-18
Family Biotinyl/lipoyl-carrier proteins and domains 0.001
Further Details:      
 
Domain Number 8 Region: 1434-1527
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 0.0000000000000105
Family PH0987 N-terminal domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TSW0|A7TSW0_VANPO
Sequence length 1832
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_299p2
Sequence
MSKSSFENTLGWTIDDWLSFHKKHDYESSLSLLKQLLRSQKVAPIDCAWISLVDESYLES
QWLLQSARDNRSQLPLLGVPIAVKDNIDVKNCLTTAGCPSFAYNPISDSTVVRLLKNAGA
IILGKTNLDQFATGLVGTRSPYGKTPCVFNQDYVSGGSSAGSASVVARGIVPLALGTDTA
GSGRVPAALNNIIGLKPTRGIVSCNGVVPACKSLDCVSIFSLNLKDAETCLRTIANPDYE
NDEYSRSLPSNPKRKFDHKLNIAIPKNIPNFGDDKNSFLFEDAVNVLKEIDANIVELDFQ
PLLDLAECLYNGPWVVERYLATKEFLERNPPLDSLDPTVLSIIESAKKFNACDVFKSEYK
RKQILQKIKNIFKDIDVLCVPTCPLNPTFKEVEQEPIKVNSIQGTWTNFVNLADLSAIAI
PAGFRNDGLPNGITLISRKFNDYALLELANRYLNYRTPFSVKAFGIFTDELKNKDKKKYE
LYGPEVTTHDSITVAVVGAHLKGFALNWQLDKVNATFIKSSKTAKKYELYALPKAGPVLK
PGLRRIGNAKGTKIELELYSIPLETFGIFMSMIPEPLGIGSVELENGEWVKSFICEEIGY
IQEGSKNISSYGGYKNYMTYLKEKESVKIFNSILVANRGEIAVRIIKSLKKLKIKSVAIY
SEIDKNSQHVHDADIAIPLIGSTTADTYLNIEQIIKIAKETSSEGIIPGYGFLSENAEFS
DTCKENGITFIGPSGQVIRDLGLKHSARELAKNANVPLVPGSSLISNVQEVKEVAQALGY
PVMIKSTAGGGGIGLQKVENEEQIESMFATVKHLGETYFGNSGVFLEKFIENARHVEVQI
LGDGKGKAIAIGERDCSLQRRNQKIIEETPPPNLPESTLIKMRNAAESLGALTKYLGAGT
VEYIYDQDRDEFYFLEVNTRLQVEHPITEVVTGLDLVEWMVKLAAGNSLSLTRDSIKVSG
VSIEARLYAENPVKNFLPSPGKLTTVEFPSWTRVDSWVSSGSVISTEYDPTLAKIIVHGN
NRSDAITKLINALSETVIQGCITNKDYLMAVLKSEFFNDATMTTHTLNSFQYSPNVFEII
TPGAHTSVQDFPGRKSYWRIGVPPSGPMDSYSFRLANKIVGNHESAAGLEITLIGPTIRF
HCNTLIALTGGEADCQLNGKNITMYSAIQVNSGDKLTIGKIVTGCRIYLSVKDGIKVPEY
LGSKSTFTLGEFGGYNGRVLKTGDLIPIVSPEDIDLSKIVSNLPKSIMPNISRNGKWEIG
VLCGPHGSPDFFEESYISEFFSSSWKVHYNSNRFGIKLIGPKPRWVRNDGGEAGLHPSNA
HDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQVVIPEAELWKVGQVKSGDSIKFHPISY
EGSRKLFQALDFKINYLKSLENEIELNQVILSKFENPILREIHSSDHDSVLSVKYRQAGD
RYILVEFGENKLDFNISYHIHSIIKNVEELQIKGIVEMSQGVRSFLIEFEPNRISQKNLL
EVLITVGNGVPFTHDWKISSKLIRLPMAFEDSKTLGCVKRYQETIRSSAPWLPNNVDFVA
SANEIKRENVYDMMYSARFMVMGLGDVYLSSPCAVPIDPRQRYLGSKYNPARTFTEKGVV
GLGGMYMCIYAASSPGGYQLVGRTIPIWDTLMLGSHSATPWMLSPFDQIEFFVVSENELD
TYVEQFDSGTFEIDVSNILFDNSVYEQWLKENKESIDAHDSKVSGEERSRLATLLSEVNV
DKVTIEEPTKDDLNKYDENACLIYSEYCGRFWKSLVNVGDIINVGDGLIVVEAMKTEMTV
ESQKSGMVKEILHKNGDIVNEGEIVVVLEPIK
Download sequence
Identical sequences A7TSW0
XP_001642500.1.22633 436907.A7TSW0 tr|A7TSW0|A7TSW0_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]