SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TT56|A7TT56_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TT56|A7TT56_VANPO
Domain Number 1 Region: 687-1129
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.05e-82
Family Reverse transcriptase 0.00026
Further Details:      
 
Domain Number 2 Region: 1340-1480
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.7e-25
Family Retroviral integrase, catalytic domain 0.0068
Further Details:      
 
Weak hits

Sequence:  tr|A7TT56|A7TT56_VANPO
Domain Number - Region: 544-644
Classification Level Classification E-value
Superfamily Acid proteases 0.0205
Family Retroviral protease (retropepsin) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TT56|A7TT56_VANPO
Sequence length 1667
Comment Tkp3 protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_298p3
Sequence
MEASIKALQESIEALNAKMDERQQEDLAYRAKIQQSFEAMNTMNTDLATKLLELKTKDDE
ERKVLKEASIEFTKFQKEQEEIKKEAKELGVELKEERKHAEAILKMEEQALQAKFEEEDK
NLENLRDGIAEEVPKYLQEFRGEIINQVNNLIAEQDNPTQGKINNNEKLQKEKILLSKIK
KHSSSIIIDEDNQIILECTKRFTDANLTPTTSMTIDSIFTKDNTLAILEIQQALINKSVK
YSDWSMFLSLCCKKNTAYHLKDARGKIMPWKNCLLSIYKFFNFQKASSIAEDEIVTRQLS
DGDNVTMFMLQLTELASTNRSTNLFHILLRKLKIIMRKEFPTLKIPNFSDFNNYEDVVTY
INEFLPEDQIYKNTNTQPTKLFALNTYQNRNKKPTQKTFYYCKNCTCNKCKNINQYQKTK
PGFCLNCSCTKCTYTKSKYYQQRRPNNEKVTTKKFNINNVELPLSDTDDYLLQEDDLDTP
NYHQSFDSGEETFSEDDQKLTENILNSYSDTNQQEEPNSHDPSPRASASMNFLDLNNTTI
KPSNPNQTNLILDTGADANFIYLPITKHKQQTINPFLITILDIIDCAPIIVKPAIGGKYI
IDKRARIKLQINNLPIEQHFFIIPEERNNIILGKPLLKILKYQLQDEHESIEIDGTRVLI
PPVLSTLTTESHIRVIKQIDIKEQLKKDFPAVFDETLLNASEPKHNYIAFVKLDNFPYHK
PKAYFTNQLQKQAINQFITQSLESNMISPIDTDEVVALSPVFPIQQSKDKIRIITDLRKV
NTHLLYTPRPIPPIQHIFSNLANKTIFSSLDIRKAYQQIPIQGDKLGLITELGSYKFNRL
PYGLASAPYWWGEFIQNILKQLPQSKDTIVSYYYDDLIIASSTIAEHYTTLKHIMALLAE
NGLSLSYEKIHIAQPKVLFLGYEVSHNRLAIDKEKKNTIARWVLPEDKKAIEKFTGFVNF
LRNFIPNASQLLAPFYSFATNKPSNHEKPILQKAMKKNFQLIKQLILKSLTLKLFDPQAP
TIIYTDASLTGAASIVLQPETVNGKTTLYPITFYSLRFTDTQQRYSTVERELWAVLHTLE
KARLVLSSSITIYTDNQGIISMGKTERATHPRLTKYLDLLNTYRLNWKYIKGRDNHVADY
LSRYGLDSQPTLNLDEWEKFSVDIKLNAVTHSDQQSKENPNLTQHTTNEHTQKAPEESRE
PATDTTDQQNNEGTPDIIQDVRNLSWSQILDIQRIIREHLPIPQIYQDIIHIFTWVNNNF
YIIYHEQLHHILTDVDYIEKATSLHNAFHANHRILEQMMIQEKFWNPRHAILLLDVIRNC
QHCEIYQRFVDLPVELPKMKITPPLTRWHLDFAGPLTTWDDFQYFIIAVDYTSNLTITKP
LISPNSNAVTDMILQIYSMFGKPRAIITDNAQAFRSEIVEQEVKRLHLKYYQSSVYNPRG
NSKAERTIRMIKKVLIHLEPDLINWPANLYNATNIVNNTKMVYGYAPCEIAFAKTAHIDY
KKYPWAPRQERQWNKRPNTAEHFQEEEQVNLAIFGHKLLHDARKITKDERSKVREMLSKV
RTDTQNDVQYIVGDPVYRLRQKNKKHEPTWDGPYTISQQVGNHTYKIKTKNGKESKYTYH
STKLRPAYAEQGSAIRTAAEYTRVYNDQERKYYIKTLEDIINDKVFN
Download sequence
Identical sequences A4VB70 A7TT56
tr|A7TT56|A7TT56_VANPO XP_001642409.1.22633 436907.A7TT56

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]