SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TT61|A7TT61_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TT61|A7TT61_VANPO
Domain Number 1 Region: 104-399
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.11e-56
Family Reverse transcriptase 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TT61|A7TT61_VANPO
Sequence length 413
Comment Tkp3 protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_544p3
Sequence
MQCPPVLIKPAIGDRYIIDKLARVRIQTNNLHIDEKFFIIPEQRNNIIFGKPLLKLLKYQ
LQDDHESIEIDGTRVIIPTVTPLLTNRPHIRLIMQTDIKEQLREQYPLVFAEPSFNNKKT
KHNYIASVRLNNFPYHKPKAYFTNQLQRQAIEQFIKQSLATKMISPIDTDELVALSPVFP
IQQSKDKIRIITDLRKVNTHLLYTPRSIPPIQHIFGNLANKTIFSSLDIRKAYQQILIKG
DKLGLITELCSYKFNRLPYGLASAPYWWGEFIQNIIKKLPQSKNTTVSYYYDDLIIASST
IAEHYTTLKHIMALLTKNGLSLSYGKIHIAEPKINFLGYELSHNRLAIDKEKKTTIAQWE
LPQDKKAIEKSTGFVNFLRNFIPNASQILAPFYQFATTKLLPNHEKPIFQKVI
Download sequence
Identical sequences A7TT61
436907.A7TT61 XP_001642404.1.22633 tr|A7TT61|A7TT61_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]