SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TT77|A7TT77_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TT77|A7TT77_VANPO
Domain Number 1 Region: 1-145,175-289
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000000734
Family Reverse transcriptase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TT77|A7TT77_VANPO
Sequence length 318
Comment Tkp5 protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_248p1
Sequence
MDVDTAFLNSQMEDAVYVKQPPSFIDSDPAHEGWVWKLYGGMYGLKQAPLFWNKHINRSL
TALGFTRNEKEFGLYFKQTADGPLLIGLYVDDLLIAAPSPRILSLTKKKLQELYSMKDLG
PVFKFLGMNITQFSNGNITLSLADYIAKAAPDQQTPLHKKVHIPLFPTINYFDDNSPVAE
NVPAYQRIVDQLIFIANAGRPDIAYSVSLLPRFLKDPRVVHVYAAHRVMQYLYTTCFQGL
SYRAGSPLQLTVYSDASHGSLADMPFSTGGYVTRLAGGCVTWSSKKIKTTVSLLPKPNIF
LLVKLLKKLNGSQTCSSI
Download sequence
Identical sequences A7TT77
XP_001642306.1.22633 XP_001642389.1.22633 tr|A7TT77|A7TT77_VANPO 436907.A7TT77

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]