SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TT79|A7TT79_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TT79|A7TT79_VANPO
Domain Number 1 Region: 381-512
Classification Level Classification E-value
Superfamily CheY-like 7.97e-36
Family CheY-related 0.0089
Further Details:      
 
Domain Number 2 Region: 85-188
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.12e-30
Family Heat-shock transcription factor 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TT79|A7TT79_VANPO
Sequence length 549
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_265p2
Sequence
MLGSKANLDTKFSALKTAKTVVTGTTLDSNSHPNSNEIKTDTDNELSMLNSTINSNNSGN
TNSNINSNSNNNSNSSNSNSKPQSNEFVRKIYGILERGDYPDIVRWTENGDSFVVLDTGS
FTSQILPNHFKHSNFASFVRQLNKYDFHKVKRTQEERKACQYGELSWEFNHPLFKRNQEA
NLDNIKRKAATQKKVLVDEKSLLLNKADGTQALENESAMNLILNNTVNSESFTQLKKKVE
KLHKEIDSYKKENDNYKIELEKLNNKYYTVLESLLTFKTVNDNLIGNFNTLCQILTSQGI
DLPQSIQYSSPQKDLKLLTTESSTQSLVNAQDSTSQSTPDNVRNVQAPTNVPIPDVIGGS
ADINSKNDDIGDVDSNELKKGFHVLLVEDDDVSIQLCSKFLRKYGCTVQVVTDGLAAISI
LEKFRFDLVLMDIVMPNLDGATATSIIRNFDNRTPIIAMTGSIEHQDLITYLQHGMNDIL
AKPFTRKDLYSILIRYLKDRVPISDQKNQLQQEQTFDNVRRSPEVHEDSQQQNIPVMMND
GPPLKKTRL
Download sequence
Identical sequences A7TT79
tr|A7TT79|A7TT79_VANPO XP_001642385.1.22633 436907.A7TT79

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]