SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TTB2|A7TTB2_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TTB2|A7TTB2_VANPO
Domain Number 1 Region: 1-212
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.63e-45
Family Reverse transcriptase 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TTB2|A7TTB2_VANPO
Sequence length 219
Comment Tkp3 protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_250p3
Sequence
MPYGLASAPYWWGEFIQRIIDEISTSTSTVIRYYYDDIIIASKSVTDHHQIVLKLFQALK
KNGLSISEEKLQLASDKVTFLGYEISADRIAIEPSKIEAIRKWELPTTKESILKLVGFIN
YLRNFIPEASEHLRPFYAMIDPKIHTTLPHVKEITHTSTPPLNHLKEWIARSLTLKLFDP
TAPTVIFSDASLTGGASIIFQPEIHNNKQTPISNYITLG
Download sequence
Identical sequences A7TTB2
tr|A7TTB2|A7TTB2_VANPO 436907.A7TTB2 XP_001642352.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]